Recombinant Akkermansia muciniphila Crossover junction endodeoxyribonuclease RuvC (ruvC)

In Stock
Code CSB-EP453002AZF
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP453002AZF could indicate that this peptide derived from E.coli-expressed Akkermansia muciniphila (strain ATCC BAA-835 / Muc) ruvC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP453002AZF could indicate that this peptide derived from E.coli-expressed Akkermansia muciniphila (strain ATCC BAA-835 / Muc) ruvC.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ruvC
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ruvC; Amuc_2024; Crossover junction endodeoxyribonuclease RuvC; EC 3.1.22.4; Holliday junction nuclease RuvC; Holliday junction resolvase RuvC
Species
Akkermansia muciniphila (strain ATCC BAA-835 / Muc)
Source
E.coli
Expression Region
1-167aa
Target Protein Sequence
MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
23.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Explore the role of Crossover junction endodeoxyribonuclease RuvC with Recombinant Akkermansia muciniphila (strain ATCC BAA-835 / Muc) ruvC protein. This full-length protein, covering the 1-167aa expression region, is sourced from E. coli, facilitating cost-effective production. The N-terminal 10xHis-tag and C-terminal Myc-tag enable efficient purification and detection, respectively. With a purity of greater than 85% as determined by SDS-PAGE, the lyophilized recombinant Akkermansia muciniphila ruvC protein offers a valuable resource for researchers focusing on epigenetics and nuclear signaling in the context of this important gut microbiome species.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.
Protein Families
RuvC family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*